SCOPe 2.03: Domain d4hoja2: 4hoj A:79-201

Lineage for d4hoja2 (4hoj A:79-201)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (36 species)
   not a true protein

7. Species Neisseria gonorrhoeae [TaxId:485] [234685] (1 PDB entry)

8. Domain d4hoja2: 4hoj A:79-201 [234686]
   Other proteins in same PDB: d4hoja1
   automated match to d3fhsa2
   complexed with act, ca, gsh

Details for d4hoja2

PDB Entry: 4hoj, 1.4 Å

PDB Description: Crystal structure of glutathione transferase homolog from Neisseria Gonorrhoeae, target EFI-501841, with bound glutathione

PDB Compounds: (A:) RegF protein

SCOPe Domain Sequences for d4hoja2:

Sequence, based on SEQRES records:

>d4hoja2 a.45.1.0 (A:79-201) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
lmpgdpvmrgrgrlvlyrmekelfnhvqvlenpaaankeqakareaigngltmlspsfsk
skyilgedfsmidvalapllwrldhydvklgksaapllkyaerifqreafiealtpaeka
mrk

Sequence, based on observed residues (ATOM records):

>d4hoja2 a.45.1.0 (A:79-201) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
lmpgdpvmrgrgrlvlyrmekelfnhvqvlenpaaankeqakareaigngltmlspssky
ilgedfsmidvalapllwrldhydvklgksaapllkyaerifqreafiealtpaekamrk

Timeline for d4hoja2:

• d4hoja2 is new in SCOPe 2.03-stable
  
• d4hoja2 appears in SCOPe 2.04
  
• d4hoja2 appears in the current release, SCOPe 2.08