Lineage for d4hoid_ (4hoi D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1922390Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1922630Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 1922864Family d.110.3.0: automated matches [191387] (1 protein)
    not a true family
  6. 1922865Protein automated matches [190492] (16 species)
    not a true protein
  7. 1922917Species Mouse (Mus musculus) [TaxId:10090] [196720] (2 PDB entries)
  8. 1922921Domain d4hoid_: 4hoi D: [196721]
    automated match to d1bywa_
    complexed with so4

Details for d4hoid_

PDB Entry: 4hoi (more details), 1.85 Å

PDB Description: Crystal structure of PAS domain from the mouse EAG1 potassium channel
PDB Compounds: (D:) Potassium voltage-gated channel subfamily H member 1

SCOPe Domain Sequences for d4hoid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hoid_ d.110.3.0 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tnfvlgnaqivdwpivysndgfcklsgyhraevmqkssacsfmygeltdkdtvekvrqtf
enyemnsfeilmykknrtpvwffvkiapirneqdkvvlflctfsditafk

SCOPe Domain Coordinates for d4hoid_:

Click to download the PDB-style file with coordinates for d4hoid_.
(The format of our PDB-style files is described here.)

Timeline for d4hoid_: