Lineage for d4geva_ (4gev A:)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
contains large mixed beta-sheetSuperfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) 
automatically mapped to Pfam PF00303Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins) 
Protein Thymidylate synthase [55833] (7 species) Species Escherichia coli [TaxId:562] [55834] (67 PDB entries) 
Domain d4geva_: 4gev A: [192445]
automated match to d2g8ma_
complexed with cb3, umc
Details for d4geva_
PDB Entry: 4gev (more details), 1.3 Å
PDB Description: e. coli thymidylate synthase y209w variant in complex with substrate and a cofactor analog
PDB Compounds: (A:) Thymidylate synthaseSCOPe Domain Sequences for d4geva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4geva_ d.117.1.1 (A:) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlwsnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai
SCOPe Domain Coordinates for d4geva_:
Click to download the PDB-style file with coordinates for d4geva_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4geva_:
- d4geva_ first appeared in SCOPe 2.02
- d4geva_ appears in SCOPe 2.05
- d4geva_ appears in SCOPe 2.07
- d4geva_ appears in the current release, SCOPe 2.08
View in 3D
