Lineage for d4e6ra_ (4e6r A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1783415Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1783856Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 1783857Protein automated matches [190457] (8 species)
    not a true protein
  7. 1783907Species Human (Homo sapiens) [TaxId:9606] [187598] (88 PDB entries)
  8. 1783936Domain d4e6ra_: 4e6r A: [220339]
    automated match to d3ulrb_
    complexed with imd, unl, zn

Details for d4e6ra_

PDB Entry: 4e6r (more details), 2.2 Å

PDB Description: crystal structure of a cytoplasmic protein nck2 (nck2) from homo sapiens at 2.20 a resolution
PDB Compounds: (A:) Cytoplasmic protein NCK2

SCOPe Domain Sequences for d4e6ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e6ra_ b.34.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
xipafvkfayvaeredelslvkgsrvtvmekcsdgwwrgsyngqigwfpsnyvleevd

SCOPe Domain Coordinates for d4e6ra_:

Click to download the PDB-style file with coordinates for d4e6ra_.
(The format of our PDB-style files is described here.)

Timeline for d4e6ra_:

1783936
d4e6ra_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d4e6rb_