Lineage for d4du6a_ (4du6 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2966179Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 2966180Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 2966181Family d.96.1.1: GTP cyclohydrolase I [55621] (2 proteins)
  6. 2966342Protein automated matches [195794] (2 species)
    not a true protein
  7. 2966403Species Yersinia pseudotuberculosis [TaxId:214092] [195796] (1 PDB entry)
  8. 2966404Domain d4du6a_: 4du6 A: [195797]
    automated match to d1gtpa_
    complexed with ca, gol, gtp, peg, trs

Details for d4du6a_

PDB Entry: 4du6 (more details), 2.11 Å

PDB Description: crystal structure of gtp cyclohydrolase i from yersinia pestis complexed with gtp
PDB Compounds: (A:) GTP cyclohydrolase 1

SCOPe Domain Sequences for d4du6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4du6a_ d.96.1.1 (A:) automated matches {Yersinia pseudotuberculosis [TaxId: 214092]}
sslskeaelvhqallargletplrkpeldaetrktriqahmtevmhllnldltddsladt
prriakmyvdeifsgldyenfpkitliqnkmkvdemvtvrditltstcehhfvtidgkat
vayipkdsviglskinrivqffaqrpqvqerltqqillalqtllgtnnvavsidavhycv
kargirdatsattttslgglfkssqntrqeflravrhhg

SCOPe Domain Coordinates for d4du6a_:

Click to download the PDB-style file with coordinates for d4du6a_.
(The format of our PDB-style files is described here.)

Timeline for d4du6a_: