Lineage for d4d01a_ (4d01 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1810672Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 1810673Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 1811013Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 1811014Protein automated matches [193506] (5 species)
    not a true protein
  7. 1811382Species Human (Homo sapiens) [TaxId:9606] [259757] (3 PDB entries)
  8. 1811385Domain d4d01a_: 4d01 A: [259758]
    automated match to d3sq6a_
    complexed with edo, nag

Details for d4d01a_

PDB Entry: 4d01 (more details), 1.8 Å

PDB Description: crystal structure of the extracellular domain of the human alpha9 nicotinic acetylcholine receptor
PDB Compounds: (A:) neuronal acetylcholine receptor subunit alpha-9

SCOPe Domain Sequences for d4d01a_:

Sequence, based on SEQRES records: (download)

>d4d01a_ b.96.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dgkyaqklfndlfedysnalrpvedtdkvlnvtlqitlsqikdmdernqiltaylwirqi
whdayltwdrdqydgldsiripsdlvwrpdivlynkaddessepvntnvvlrydglitwd
apaitksscvvdvtyfpfdnqqcnltfgswtyngnqvdifnaldsgdlsdfiedvewevh
gmpavknvisygccsepypdvtftlllkrrshhh

Sequence, based on observed residues (ATOM records): (download)

>d4d01a_ b.96.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dgkyaqklfndlfedysnalrpvedtdkvlnvtlqitlsqikdmdernqiltaylwirqi
whdayltwdrdqydgldsiripsdlvwrpdivlynkaddeepvntnvvlrydglitwdap
aitksscvvdvtyfpfdnqqcnltfgswtyngnqvdifnaldsgdlsdfiedvewevhgm
pavknvisygccsepypdvtftlllkrrshhh

SCOPe Domain Coordinates for d4d01a_:

Click to download the PDB-style file with coordinates for d4d01a_.
(The format of our PDB-style files is described here.)

Timeline for d4d01a_: