Class b: All beta proteins [48724] (176 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) |
Family b.96.1.0: automated matches [193505] (1 protein) not a true family |
Protein automated matches [193506] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [259757] (3 PDB entries) |
Domain d4d01a_: 4d01 A: [259758] automated match to d3sq6a_ complexed with edo, nag |
PDB Entry: 4d01 (more details), 1.8 Å
SCOPe Domain Sequences for d4d01a_:
Sequence, based on SEQRES records: (download)
>d4d01a_ b.96.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dgkyaqklfndlfedysnalrpvedtdkvlnvtlqitlsqikdmdernqiltaylwirqi whdayltwdrdqydgldsiripsdlvwrpdivlynkaddessepvntnvvlrydglitwd apaitksscvvdvtyfpfdnqqcnltfgswtyngnqvdifnaldsgdlsdfiedvewevh gmpavknvisygccsepypdvtftlllkrrshhh
>d4d01a_ b.96.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dgkyaqklfndlfedysnalrpvedtdkvlnvtlqitlsqikdmdernqiltaylwirqi whdayltwdrdqydgldsiripsdlvwrpdivlynkaddeepvntnvvlrydglitwdap aitksscvvdvtyfpfdnqqcnltfgswtyngnqvdifnaldsgdlsdfiedvewevhgm pavknvisygccsepypdvtftlllkrrshhh
Timeline for d4d01a_: