![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
![]() | Superfamily c.72.1: Ribokinase-like [53613] (6 families) ![]() has extra strand located between strands 2 and 3 |
![]() | Family c.72.1.0: automated matches [191321] (1 protein) not a true family |
![]() | Protein automated matches [190117] (40 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:1280] [187913] (4 PDB entries) |
![]() | Domain d4c5na_: 4c5n A: [237775] automated match to d1jxha_ complexed with acp, pxl, so4, ueg |
PDB Entry: 4c5n (more details), 1.75 Å
SCOPe Domain Sequences for d4c5na_:
Sequence, based on SEQRES records: (download)
>d4c5na_ c.72.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]} galkkvltiagsdtsagagmqadlktfqeldtygmvaltaivtmdkdtwshdvtplpmdv fekqletalsigpdaiktgmlgteeiikragevyeasnaqyfvvdpvmvckgedevlnpg nteamikyllpkatvvtpnlfeagqlsglgklnsiedmkkaatiifdkgaqhviikggka ldqdksydlyydgqtfyqlttdmfqqsynhgagctfaaattaylangkspkeavisakaf vasaikngwkmndfvgpvdhgaynriehidvevtev
>d4c5na_ c.72.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]} galkkvltiagsdtsagagmqadlktfqeldtygmvaltaivtmdkdtwshdvtplpmdv fekqletalsigpdaiktgmlgteeiikragevyeasnaqyfvvdpvmlnpgnteamiky llpkatvvtpnlfeagqlsglgklnsiedmkkaatiifdkgaqhviikggkaldqdksyd lyydgqtfyqlttdmfqqsynhgagctfaaattaylangkspkeavisakafvasaikng wkmndfvgpvdhgaynriehidvevtev
Timeline for d4c5na_: