Lineage for d4c2mf_ (4c2m F:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2347782Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 2347783Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 2347834Family a.143.1.2: RPB6 [55294] (2 proteins)
  6. 2347835Protein RPB6 [55295] (3 species)
    essential subunit of RNA polymerases I, II and III
  7. 2347836Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (31 PDB entries)
    Uniprot P20435; part of multichain biological unit
  8. 2347844Domain d4c2mf_: 4c2m F: [228425]
    Other proteins in same PDB: d4c2m1_, d4c2m2_, d4c2m3_, d4c2ma_, d4c2mb_, d4c2mc1, d4c2mc2, d4c2me1, d4c2me2, d4c2mg1, d4c2mh_, d4c2mi1, d4c2mi2, d4c2mj_, d4c2mk_, d4c2ml_, d4c2mm_, d4c2mn_, d4c2mp_, d4c2mq_, d4c2mr1, d4c2mr2, d4c2mt1, d4c2mt2, d4c2mv1, d4c2mw_, d4c2mx1, d4c2mx2, d4c2my_, d4c2mz_
    automated match to d2nvqf_
    complexed with so4, zn

Details for d4c2mf_

PDB Entry: 4c2m (more details), 2.8 Å

PDB Description: structure of rna polymerase i at 2.8 a resolution
PDB Compounds: (F:) DNA-directed RNA polymerases I, II, and III subunit rpabc 2

SCOPe Domain Sequences for d4c2mf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c2mf_ a.143.1.2 (F:) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pedfqqheqirrktlkekaipkdqrattpymtkyerarilgtralqismnapvfvdlege
tdplriamkelaekkiplvirrylpdgsfedwsveelivd

SCOPe Domain Coordinates for d4c2mf_:

Click to download the PDB-style file with coordinates for d4c2mf_.
(The format of our PDB-style files is described here.)

Timeline for d4c2mf_: