SCOPe 2.07: Domain d4c2mi2: 4c2m I:65-125

Lineage for d4c2mi2 (4c2m I:65-125)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.3: Zinc beta-ribbon [57783] (6 families)

5. Family g.41.3.1: Transcriptional factor domain [57784] (6 proteins)

6. Protein RNA polymerase I subunit A12.2 [346126] (1 species)
   contains two differently decorated domains of this fold

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346434] (2 PDB entries)

8. Domain d4c2mi2: 4c2m I:65-125 [343925]
   Other proteins in same PDB: d4c2m1_, d4c2m2_, d4c2m3_, d4c2ma_, d4c2mb_, d4c2mc1, d4c2mc2, d4c2me1, d4c2me2, d4c2mf_, d4c2mg1, d4c2mh_, d4c2mj_, d4c2mk_, d4c2ml_, d4c2mm_, d4c2mn_, d4c2mp_, d4c2mq_, d4c2mr1, d4c2mr2, d4c2mt1, d4c2mt2, d4c2mu_, d4c2mv1, d4c2mw_, d4c2my_, d4c2mz_
   automated match to d4c3hi2
   complexed with so4, zn

Details for d4c2mi2

PDB Entry: 4c2m, 2.8 Å

PDB Description: structure of rna polymerase i at 2.8 a resolution

PDB Compounds: (I:) DNA-directed RNA polymerase I subunit rpa12

SCOPe Domain Sequences for d4c2mi2:

Sequence; same for both SEQRES and ATOM records:

>d4c2mi2 g.41.3.1 (I:65-125) RNA polymerase I subunit A12.2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
svvktslkknelkdgatikekcpqcgneemnyhtlqlrsadegatvfytctscgykfrtn
n

Timeline for d4c2mi2:

• d4c2mi2 is new in SCOPe 2.07-stable
  
• d4c2mi2 appears in the current release, SCOPe 2.08