Lineage for d4aw3a_ (4aw3 A:)
- Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds) 
Fold a.104: Cytochrome P450 [48263] (1 superfamily)
multihelicalSuperfamily a.104.1: Cytochrome P450 [48264] (2 families) 
Family a.104.1.0: automated matches [191509] (1 protein)
not a true familyProtein automated matches [190847] (64 species)
not a true protein
Species Micromonospora griseorubida [TaxId:28040] [226290] (10 PDB entries) 
Domain d4aw3a_: 4aw3 A: [219179]
automated match to d3e5la_
complexed with gol, hem, myv, so4; mutant
Details for d4aw3a_
PDB Entry: 4aw3 (more details), 2.05 Å
PDB Description: Structure of the mixed-function P450 MycG F286V mutant in complex with mycinamicin V in P1 space group
PDB Compounds: (A:) p-450-like proteinSCOPe Domain Sequences for d4aw3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4aw3a_ a.104.1.0 (A:) automated matches {Micromonospora griseorubida [TaxId: 28040]}
epraypfndvhgltlagrygelqetepvsrvrppygeeawlvtryedvravlgdgrfvrg
psmtrdeprtrpemvkggllsmdppehsrlrrlvvkaftarraeslrprareiahelvdq
maatgqpadlvamfarqlpvrvicellgvpsadhdrftrwsgaflstaevtaeemqeaae
qayaymgdlidrrrkeptddlvsalvqardqqdslseqelldlaigllvagyestttqia
dfvyllmtrpelrrqlldrpelipsaveeltrwvplgvgtavpryavedvtlrgvtirag
epvlastgaanrdqaqfpdadridvdrtpnqhlgfghgvhhclgaplarvelqvalevll
qrlpgirlgipetqlrwsegmllrgplelpvvw
SCOPe Domain Coordinates for d4aw3a_:
Click to download the PDB-style file with coordinates for d4aw3a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4aw3a_:
- d4aw3a_ first appeared in SCOPe 2.03
- d4aw3a_ appears in SCOPe 2.05
- d4aw3a_ appears in SCOPe 2.07
- d4aw3a_ appears in the current release, SCOPe 2.08
View in 3D
