Class a: All alpha proteins [46456] (284 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
Protein automated matches [190435] (8 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [193902] (5 PDB entries) |
Domain d3vpnb_: 3vpn B: [193905] automated match to d2uw2a1 complexed with fe, mg; mutant |
PDB Entry: 3vpn (more details), 2.25 Å
SCOPe Domain Sequences for d3vpnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vpnb_ a.25.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mgvedepllrenprrfvifpieyhdiwqmykkaeasfwtaedvdlskdiqhweslkpeer yfishvlaffaasdgivnenlverfsqevqitearcfygfqiamenihsemysllidtyi kdpkereflfnaietmpcvkkkadwalrwigdkeatygervvafaavegiffsgsfasif wlkkrglmpgltfsnelisrdeglhcdfaclmfkhlvhkpseervreiiinavrieqefl tealpvkligmnctlmkqyiefvadrlmlelgfskvfrvenpfdfm
Timeline for d3vpnb_: