Lineage for d3vfea_ (3vfe A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404432Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2406349Protein automated matches [190044] (14 species)
    not a true protein
  7. 2406399Species Human (Homo sapiens) [TaxId:9606] [187233] (166 PDB entries)
  8. 2406520Domain d3vfea_: 3vfe A: [194275]
    automated match to d1lo6a_
    complexed with 0hl

Details for d3vfea_

PDB Entry: 3vfe (more details), 1.88 Å

PDB Description: virtual screening and x-ray crystallography for human kallikrein 6 inhibitors with an amidinothiophene p1 group
PDB Compounds: (A:) Kallikrein-6

SCOPe Domain Sequences for d3vfea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vfea_ b.47.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lvhggpcdktshpyqaalytsghllcggvlihplwvltaahckkpnlqvflgkhnlgqqe
ssqeqssvvravihpdydaashdqdimllrlarpaklseliqplplerdcsaqttschil
gwgktadgdfpdtiqcayihlvsreecehaypgqitqnmlcagdekygkdscqgdsggpl
vcgdhlrglvswgnipcgskekpgvytnvcrytnwiqktiqa

SCOPe Domain Coordinates for d3vfea_:

Click to download the PDB-style file with coordinates for d3vfea_.
(The format of our PDB-style files is described here.)

Timeline for d3vfea_: