Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (91 species) not a true protein |
Species Oleispira antarctica [TaxId:188908] [226283] (2 PDB entries) |
Domain d3vcra_: 3vcr A: [217764] automated match to d1vlwb_ complexed with pyr |
PDB Entry: 3vcr (more details), 1.84 Å
SCOPe Domain Sequences for d3vcra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vcra_ c.1.10.0 (A:) automated matches {Oleispira antarctica [TaxId: 188908]} mtqldtwlantkplipvividdlvhaipmakalvaggvhllevtlrteaglaaisaikka vpeaivgagtvctaddfqkaidagaqfivspgltpeliekakqvkldgqwqgvflpgvat asevmiaaqagitqlkcfpasaiggakllkawsgpfpdiqfcptggiskdnykeylglpn vicaggswltesklliegdwnevtrraseivklsdi
Timeline for d3vcra_: