Lineage for d3v0qa_ (3v0q A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the restSuperfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) 
Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 proteins)
automatically mapped to Pfam PF03414
Protein automated matches [190178] (2 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [186910] (57 PDB entries) 
Domain d3v0qa_: 3v0q A: [192612]
automated match to d3sxga_
complexed with bhe, gol, mn, so4, udp; mutant
Details for d3v0qa_
PDB Entry: 3v0q (more details), 1.8 Å
PDB Description: Crystal structure of the Fucosylgalactoside alpha N-acetylgalactosaminyltransferase (GTA, cisAB mutant L266G, G268A) in complex with UDP and H-antigen acceptor
PDB Compounds: (A:) Histo-blood group ABO system transferaseSCOPe Domain Sequences for d3v0qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v0qa_ c.68.1.9 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aigefmvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttig
ltvfaikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevra
ykrwqdvsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpgfy
gssreaftyerrpqsqayipkdegdfyyggaffggsvqevqrltrachqammvdqangie
avwhdeshlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavpknhqavrnp
SCOPe Domain Coordinates for d3v0qa_:
Click to download the PDB-style file with coordinates for d3v0qa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3v0qa_:
- d3v0qa_ first appeared in SCOPe 2.02
- d3v0qa_ appears in SCOPe 2.04
- d3v0qa_ is called d3v0qa1 in SCOPe 2.06
- d3v0qa_ appears in the current release, SCOPe 2.08, called d3v0qa1
View in 3D
