Lineage for d3tlrc_ (3tlr C:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1290588Protein beta2-microglobulin [88600] (5 species)
  7. 1290600Species Human (Homo sapiens) [TaxId:9606] [88602] (342 PDB entries)
    Uniprot P61769 21-119 ! Uniprot P01884
  8. 1290932Domain d3tlrc_: 3tlr C: [194723]
    automated match to d1k5nb_
    complexed with cd, na; mutant

Details for d3tlrc_

PDB Entry: 3tlr (more details), 2.45 Å

PDB Description: Crystal Structure of the tetrameric Beta-2 microglobulin DIMC20 mutant
PDB Compounds: (C:) Beta-2-microglobulin

SCOPe Domain Sequences for d3tlrc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tlrc_ b.1.1.2 (C:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]}
miqrtpkiqvysrhpaengkcnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm

SCOPe Domain Coordinates for d3tlrc_:

Click to download the PDB-style file with coordinates for d3tlrc_.
(The format of our PDB-style files is described here.)

Timeline for d3tlrc_: