Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.53: Resolvase-like [53040] (2 superfamilies) Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest |
Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families) |
Family c.53.2.0: automated matches [191506] (1 protein) not a true family |
Protein automated matches [190830] (7 species) not a true protein |
Species Acidianus sp. [TaxId:1071056] [193625] (2 PDB entries) |
Domain d3teoo_: 3teo O: [193626] automated match to d3lasa_ complexed with cl, pe3 |
PDB Entry: 3teo (more details), 2.4 Å
SCOPe Domain Sequences for d3teoo_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3teoo_ c.53.2.0 (O:) automated matches {Acidianus sp. [TaxId: 1071056]} vseyidselkrledyalrrvkgipnnrrlwvltcmdervhieqslgiqpddahiyrnagg ivtddairsaslttnffgtkeiivvthtdcgmlrftgeevakyfiskgikptevqldpll pafrisseedfikwfkfyedlgvkspdemalkgveilrnhplipkdvritgyvyevethr lrkpnqiiynetskfehgtivk
Timeline for d3teoo_: