Lineage for d3teoo_ (3teo O:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857121Fold c.53: Resolvase-like [53040] (2 superfamilies)
    Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 1857166Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families) (S)
  5. 1857284Family c.53.2.0: automated matches [191506] (1 protein)
    not a true family
  6. 1857285Protein automated matches [190830] (7 species)
    not a true protein
  7. 1857286Species Acidianus sp. [TaxId:1071056] [193625] (2 PDB entries)
  8. 1857301Domain d3teoo_: 3teo O: [193626]
    automated match to d3lasa_
    complexed with cl, pe3

Details for d3teoo_

PDB Entry: 3teo (more details), 2.4 Å

PDB Description: apo form of carbon disulfide hydrolase (selenomethionine form)
PDB Compounds: (O:) Carbon disulfide hydrolase

SCOPe Domain Sequences for d3teoo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3teoo_ c.53.2.0 (O:) automated matches {Acidianus sp. [TaxId: 1071056]}
vseyidselkrledyalrrvkgipnnrrlwvltcmdervhieqslgiqpddahiyrnagg
ivtddairsaslttnffgtkeiivvthtdcgmlrftgeevakyfiskgikptevqldpll
pafrisseedfikwfkfyedlgvkspdemalkgveilrnhplipkdvritgyvyevethr
lrkpnqiiynetskfehgtivk

SCOPe Domain Coordinates for d3teoo_:

Click to download the PDB-style file with coordinates for d3teoo_.
(The format of our PDB-style files is described here.)

Timeline for d3teoo_: