Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (239 species) not a true protein |
Species Bacillus anthracis [TaxId:198094] [189998] (4 PDB entries) |
Domain d3sc6a_: 3sc6 A: [185352] Other proteins in same PDB: d3sc6b2, d3sc6d2 automated match to d1vl0b_ complexed with nap, so4 |
PDB Entry: 3sc6 (more details), 2.65 Å
SCOPe Domain Sequences for d3sc6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sc6a_ c.2.1.0 (A:) automated matches {Bacillus anthracis [TaxId: 198094]} kerviitgangqlgkqlqeelnpeeydiypfdkkllditnisqvqqvvqeirphiiihca aytkvdqaekerdlayvinaigarnvavasqlvgaklvyistdyvfqgdrpegydefhnp apiniygaskyageqfvkelhnkyfivrtswlygkygnnfvktmirlgkereeisvvadq igsptyvadlnvminklihtslygtyhvsntgscswfefakkifsyanmkvnvlpvstee fgaaaarpkysifqhnmlrlngflqmpsweeglerffietk
Timeline for d3sc6a_: