Lineage for d3qskb_ (3qsk B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2023922Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (33 PDB entries)
  8. 2023934Domain d3qskb_: 3qsk B: [184610]
    Other proteins in same PDB: d3qska_
    automated match to d1bzqk_
    protein/RNA complex

Details for d3qskb_

PDB Entry: 3qsk (more details), 1.75 Å

PDB Description: 5 Histidine Variant of the anti-RNase A VHH in Complex with RNAse A
PDB Compounds: (B:) Engineered 5 Histidine anti-RNase A Camelid VHH Antibody Domain Variant

SCOPe Domain Sequences for d3qskb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qskb_ b.1.1.1 (B:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
gsqvqlvesggglvqaggslrlscaasgyhhpyiymgwfrqapgkeregvaamdsggggt
lyadsvkgrftisrdkgkntvylqmdslkpedtatyycaagghhlrdhtygqwgqgtqvt
vss

SCOPe Domain Coordinates for d3qskb_:

Click to download the PDB-style file with coordinates for d3qskb_.
(The format of our PDB-style files is described here.)

Timeline for d3qskb_:

2023934
d3qskb_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d3qska_