Class a: All alpha proteins [46456] (284 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (18 species) not a true protein |
Species Novosphingobium aromaticivorans [TaxId:279238] [189372] (5 PDB entries) |
Domain d3ofua_: 3ofu A: [183000] automated match to d1k2oa_ complexed with hem, id3 |
PDB Entry: 3ofu (more details), 2.8 Å
SCOPe Domain Sequences for d3ofua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ofua_ a.104.1.0 (A:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]} mipahvpadrvvdfdifnppgveqdyfaawktlldgpglvwstangghwiaargdvvrel wgdaerlssqclavtpglgkvmqfiplqqdgaehkafrtpvmkglasrfvvalepkvqav arklmeslrprgscdfvsdfaeilplnifltlidvpledrprlrqlgvqltrpdgsmtve qlkqaaddylwpfiekrmaqpgddlfsrilsepvggrpwtvdearrmcrnllfggldtva amigmvalhlarhpedqrllrerpdlipaaadelmrryptvavsrnavadvdadgvtirk gdlvylpsvlhnldpasfeapeevrfdrglapirhttmgvgahrcvgaglarmevivflr ewlggmpefalapdkavtmkggnvgactalplvwra
Timeline for d3ofua_: