SCOPe 2.06: Domain d3o8xc1: 3o8x C:1-117

Lineage for d3o8xc1 (3o8x C:1-117)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.0: automated matches [191470] (1 protein)
not a true family
Protein automated matches [190740] (28 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)
Domain d3o8xc1: 3o8x C:1-117 [200018]
Other proteins in same PDB: d3o8xa1, d3o8xa2, d3o8xb_, d3o8xc2, d3o8xd1, d3o8xd2
automated match to d1qrnd1
complexed with gsl, nag

Details for d3o8xc1

PDB Entry: 3o8x (more details), 2.74 Å

PDB Description: recognition of glycolipid antigen by inkt cell tcr

PDB Compounds: (C:) Valpha14 chimera (Mouse variable domain, Human T-cell receptor alpha chain C region constant domain)

SCOPe Domain Sequences for d3o8xc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o8xc1 b.1.1.0 (C:1-117) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tqveqspqslvvrqgencvlqcnysvtpdnhlrwfkqdtgkglvsltvlvdqkdktsngr
ysatldkdakhstlhitatllddtatyicvvgdrgsalgrlhfgagtqlivipd

SCOPe Domain Coordinates for d3o8xc1:

Click to download the PDB-style file with coordinates for d3o8xc1.
(The format of our PDB-style files is described here.)

Timeline for d3o8xc1: