Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.5: G-type lysozyme [53987] (2 proteins) |
Protein automated matches [191098] (2 species) not a true protein |
Species Atlantic salmon (Salmo salar) [TaxId:8030] [189321] (2 PDB entries) |
Domain d3mgwa_: 3mgw A: [181209] automated match to d153la_ complexed with co, so4 |
PDB Entry: 3mgw (more details), 1.75 Å
SCOPe Domain Sequences for d3mgwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mgwa_ d.2.1.5 (A:) automated matches {Atlantic salmon (Salmo salar) [TaxId: 8030]} hhditkvdtsgaseitarqdkltlqgvdashklaehdlvrmnkykelitrvgqkhgldpa iiagiisresragsaldhgwgdhgkgfglmqvdkryhkivgawdsekhisqgteiliefi rriqakfpvwpkehqlkggisaynagdknvrtyermdvgttggdysndvvarsqwfksqg y
Timeline for d3mgwa_: