Lineage for d3llea_ (3lle A:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.39: EF Hand-like [47472] (4 superfamilies)
core: 4 helices; array of 2 hairpins, openedSuperfamily a.39.1: EF-hand [47473] (12 families) 
Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
Family a.39.1.2: S100 proteins [47478] (2 proteins)
dimer: subunits are made of two EF-handsProtein Calcyclin (S100) [47479] (17 species) 
Species Cow (Bos taurus), s100b [TaxId:9913] [47482] (21 PDB entries) 
Domain d3llea_: 3lle A: [180370]
automated match to d1cfpa_
complexed with ca, sge
Details for d3llea_
PDB Entry: 3lle (more details), 1.85 Å
PDB Description: x-ray structure of bovine sc0322,ca(2+)-s100b
PDB Compounds: (A:) Protein S100-BSCOPe Domain Sequences for d3llea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3llea_ a.39.1.2 (A:) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]}
mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldsdgdgecdfqefmafvamittacheffe
SCOPe Domain Coordinates for d3llea_:
Click to download the PDB-style file with coordinates for d3llea_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3llea_:
- d3llea_ first appeared in SCOPe 2.01
- d3llea_ appears in SCOPe 2.04
- d3llea_ appears in SCOPe 2.06
- d3llea_ appears in the current release, SCOPe 2.08
View in 3D
