Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
Protein automated matches [226860] (30 species) not a true protein |
Species Pseudoalteromonas haloplanktis [TaxId:326442] [225960] (4 PDB entries) |
Domain d3lioa2: 3lio A:83-192 [212902] Other proteins in same PDB: d3lioa1, d3liob1 automated match to d2nyba2 complexed with fe, tre |
PDB Entry: 3lio (more details), 1.5 Å
SCOPe Domain Sequences for d3lioa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lioa2 d.44.1.0 (A:83-192) automated matches {Pseudoalteromonas haloplanktis [TaxId: 326442]} ngggaptgavadainakwgsfdafkealndkavnnfgsswtwlvkladgsldivntsnaa tpltddgvtpiltvdlwehayyidyrnvrpdylkgfwslvnwefananfa
Timeline for d3lioa2: