Class b: All beta proteins [48724] (177 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) |
Family b.2.3.2: Pilus subunits [49405] (10 proteins) |
Protein BcpA pilus subunit (XNA) [310721] (1 species) |
Species Bacillus cereus ATCC 14579 [TaxId:226900] [310968] (1 PDB entry) |
Domain d3kpta3: 3kpt A:268-408 [305717] Other proteins in same PDB: d3kpta1, d3kpta2, d3kptb1, d3kptb2, d3kptb4 complexed with ca |
PDB Entry: 3kpt (more details), 2.1 Å
SCOPe Domain Sequences for d3kpta3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kpta3 b.2.3.2 (A:268-408) BcpA pilus subunit (XNA) {Bacillus cereus ATCC 14579 [TaxId: 226900]} eptidkkingklealpinpltnynydiktlipedikeykkyvvtdtldnrlviqgkpivk idgaevnanvvevaiegqkvtatvkdftkmdgkkefhlqiksqvkegvpsgseilntaki hftnkndvigekeskpvvvip
Timeline for d3kpta3:
View in 3D Domains from other chains: (mouse over for more information) d3kptb1, d3kptb2, d3kptb3, d3kptb4 |