Lineage for d3kpta3 (3kpt A:268-408)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2040316Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2040518Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2040523Family b.2.3.2: Pilus subunits [49405] (10 proteins)
  6. 2040524Protein BcpA pilus subunit (XNA) [310721] (1 species)
  7. 2040525Species Bacillus cereus ATCC 14579 [TaxId:226900] [310968] (1 PDB entry)
  8. 2040526Domain d3kpta3: 3kpt A:268-408 [305717]
    Other proteins in same PDB: d3kpta1, d3kpta2, d3kptb1, d3kptb2, d3kptb4
    complexed with ca

Details for d3kpta3

PDB Entry: 3kpt (more details), 2.1 Å

PDB Description: crystal structure of bcpa, the major pilin subunit of bacillus cereus
PDB Compounds: (A:) Collagen adhesion protein

SCOPe Domain Sequences for d3kpta3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kpta3 b.2.3.2 (A:268-408) BcpA pilus subunit (XNA) {Bacillus cereus ATCC 14579 [TaxId: 226900]}
eptidkkingklealpinpltnynydiktlipedikeykkyvvtdtldnrlviqgkpivk
idgaevnanvvevaiegqkvtatvkdftkmdgkkefhlqiksqvkegvpsgseilntaki
hftnkndvigekeskpvvvip

SCOPe Domain Coordinates for d3kpta3:

Click to download the PDB-style file with coordinates for d3kpta3.
(The format of our PDB-style files is described here.)

Timeline for d3kpta3: