Lineage for d3hilb_ (3hil B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1493397Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1493398Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 1493535Family a.60.1.0: automated matches [191306] (1 protein)
    not a true family
  6. 1493536Protein automated matches [190031] (2 species)
    not a true protein
  7. 1493541Species Human (Homo sapiens) [TaxId:9606] [188353] (18 PDB entries)
  8. 1493546Domain d3hilb_: 3hil B: [211078]
    automated match to d3kkaa_
    complexed with cl, no3

Details for d3hilb_

PDB Entry: 3hil (more details), 2 Å

PDB Description: SAM Domain of Human Ephrin Type-A Receptor 1 (EphA1)
PDB Compounds: (B:) Ephrin type-A receptor 1

SCOPe Domain Sequences for d3hilb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hilb_ a.60.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ipyrtvsewlesirmkryilhfhsagldtmecvleltaedltqmgitlpghqkrilcsiq
gf

SCOPe Domain Coordinates for d3hilb_:

Click to download the PDB-style file with coordinates for d3hilb_.
(The format of our PDB-style files is described here.)

Timeline for d3hilb_:

1493546
d3hilb_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d3hila_