Lineage for d3h82b_ (3h82 B:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.110: Profilin-like [55769] (10 superfamilies)
core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alphaSuperfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) 
alpha-beta(2)-alpha(2)-beta(3)
Family d.110.3.0: automated matches [191387] (1 protein)
not a true familyProtein automated matches [190492] (16 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187434] (18 PDB entries) 
Domain d3h82b_: 3h82 B: [177317]
Other proteins in same PDB: d3h82a_
automated match to d1p97a_
protein/DNA complex; complexed with 020
Details for d3h82b_
PDB Entry: 3h82 (more details), 1.5 Å
PDB Description: crystal structure of the high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains with the artificial ligand ths020
PDB Compounds: (B:) Aryl hydrocarbon receptor nuclear translocatorSCOPe Domain Sequences for d3h82b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h82b_ d.110.3.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lnvcqptrfisrhniegiftfvdhrcvatvgyqpqellgknivefchpedqqllrdsfqq
vvklkgqvlsvmfrfrsknqewlwmrtssftfqnpysdeieyiictntnvkns
SCOPe Domain Coordinates for d3h82b_:
Click to download the PDB-style file with coordinates for d3h82b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3h82b_:
- d3h82b_ first appeared in SCOPe 2.01
- d3h82b_ appears in SCOPe 2.04
- d3h82b_ is called d3h82b1 in SCOPe 2.06
- d3h82b_ appears in the current release, SCOPe 2.08, called d3h82b1
View in 3D
