Lineage for d3h5qa2 (3h5q A:71-330)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2469961Fold c.27: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52417] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2469962Superfamily c.27.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52418] (2 families) (S)
    automatically mapped to Pfam PF00591
  5. 2470042Family c.27.1.0: automated matches [254295] (1 protein)
    not a true family
  6. 2470043Protein automated matches [254679] (2 species)
    not a true protein
  7. 2470049Species Staphylococcus aureus [TaxId:93062] [255859] (1 PDB entry)
  8. 2470050Domain d3h5qa2: 3h5q A:71-330 [246470]
    Other proteins in same PDB: d3h5qa1, d3h5qa3, d3h5qa4
    automated match to d1brwa2
    complexed with so4, thm

Details for d3h5qa2

PDB Entry: 3h5q (more details), 1.94 Å

PDB Description: crystal structure of a putative pyrimidine-nucleoside phosphorylase from staphylococcus aureus
PDB Compounds: (A:) Pyrimidine-nucleoside phosphorylase

SCOPe Domain Sequences for d3h5qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h5qa2 c.27.1.0 (A:71-330) automated matches {Staphylococcus aureus [TaxId: 93062]}
lsdikgvkvdkhstggvgdtttlvlaplvaavdvpvakmsgrglghtggtidkleaidgf
hveideatfvklvnenkvavvgqsgnltpadkklyalrdvtgtvnsipliassimskkia
agadaivldvktgsgafmktledaealahamvrignnvgrntmaiisdmnqplgraigna
lelqeaidtlkgqgpkdltelvltlgsqmvvlankaetleearallieainsgaalekfk
tfiknqggdetvidhperlp

SCOPe Domain Coordinates for d3h5qa2:

Click to download the PDB-style file with coordinates for d3h5qa2.
(The format of our PDB-style files is described here.)

Timeline for d3h5qa2: