![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies) 4 helices; bundle, left-handed twist; right-handed superhelix |
![]() | Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families) ![]() automatically mapped to Pfam PF02885 |
![]() | Family a.46.2.0: automated matches [254276] (1 protein) not a true family |
![]() | Protein automated matches [254641] (5 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:93062] [255858] (1 PDB entry) |
![]() | Domain d3h5qa1: 3h5q A:1-70 [246469] Other proteins in same PDB: d3h5qa2, d3h5qa3, d3h5qa4 automated match to d1brwa1 complexed with so4, thm |
PDB Entry: 3h5q (more details), 1.94 Å
SCOPe Domain Sequences for d3h5qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h5qa1 a.46.2.0 (A:1-70) automated matches {Staphylococcus aureus [TaxId: 93062]} mrmidiiekkrdghtltteeinffiggyvkgdipdyqasslamaiyfqdmnddervaltm amvnsgdmid
Timeline for d3h5qa1: