Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (2 families) can be classified as disulfide-rich |
Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
Protein automated matches [190061] (6 species) not a true protein |
Species Frog (Rana pipiens) [TaxId:8404] [188156] (4 PDB entries) |
Domain d3fd7a_: 3fd7 A: [175705] automated match to d1onca_ complexed with edo, gol, so4 |
PDB Entry: 3fd7 (more details), 1.53 Å
SCOPe Domain Sequences for d3fd7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fd7a_ d.5.1.1 (A:) automated matches {Frog (Rana pipiens) [TaxId: 8404]} edwltfqkkhitntrdvdcdnimstnlfhckdkntfiysrpepvkaickgiiasknvltt sefylsdcnvtsrpckyklkkstnkfavtcenqapvhfvgvgs
Timeline for d3fd7a_: