Lineage for d3f0na1 (3f0n A:7-193)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930912Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 2930913Protein automated matches [190826] (23 species)
    not a true protein
  7. 2931085Species Mouse (Mus musculus) [TaxId:10090] [225562] (1 PDB entry)
  8. 2931086Domain d3f0na1: 3f0n A:7-193 [209755]
    Other proteins in same PDB: d3f0na2, d3f0na3, d3f0nb2
    automated match to d1fi4a1
    complexed with po4

Details for d3f0na1

PDB Entry: 3f0n (more details), 1.9 Å

PDB Description: mus musculus mevalonate pyrophosphate decarboxylase
PDB Compounds: (A:) mevalonate pyrophosphate decarboxylase

SCOPe Domain Sequences for d3f0na1:

Sequence, based on SEQRES records: (download)

>d3f0na1 d.14.1.0 (A:7-193) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlmvtctapvniavikywgkrdealilpinsslsvtlhqdqlkttttvaiskdftedriw
lngreedvgqprlqaclreirrlarkrrstedgdtlplslsykvhvasvnnfptaaglas
saagyaclaytlaqvygvegdlsevarrgsgsacrslyggfvewqmgeqadgkdsiarqi
apewhwp

Sequence, based on observed residues (ATOM records): (download)

>d3f0na1 d.14.1.0 (A:7-193) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlmvtctapvniavikywgkrdealilpinsslsvtlhqdqlkttttvaiskdftedriw
lngreedvgqprlqaclreirrlarkdtlplslsykvhvasvnnfptaaglassaagyac
laytlaqvygvegdlsevarrgsgsacrslyggfvewqmgeqadgkdsiarqiapewhwp

SCOPe Domain Coordinates for d3f0na1:

Click to download the PDB-style file with coordinates for d3f0na1.
(The format of our PDB-style files is described here.)

Timeline for d3f0na1: