Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.0: automated matches [191504] (1 protein) not a true family |
Protein automated matches [190826] (23 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [225562] (1 PDB entry) |
Domain d3f0na1: 3f0n A:7-193 [209755] Other proteins in same PDB: d3f0na2, d3f0na3, d3f0nb2 automated match to d1fi4a1 complexed with po4 |
PDB Entry: 3f0n (more details), 1.9 Å
SCOPe Domain Sequences for d3f0na1:
Sequence, based on SEQRES records: (download)
>d3f0na1 d.14.1.0 (A:7-193) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dlmvtctapvniavikywgkrdealilpinsslsvtlhqdqlkttttvaiskdftedriw lngreedvgqprlqaclreirrlarkrrstedgdtlplslsykvhvasvnnfptaaglas saagyaclaytlaqvygvegdlsevarrgsgsacrslyggfvewqmgeqadgkdsiarqi apewhwp
>d3f0na1 d.14.1.0 (A:7-193) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dlmvtctapvniavikywgkrdealilpinsslsvtlhqdqlkttttvaiskdftedriw lngreedvgqprlqaclreirrlarkdtlplslsykvhvasvnnfptaaglassaagyac laytlaqvygvegdlsevarrgsgsacrslyggfvewqmgeqadgkdsiarqiapewhwp
Timeline for d3f0na1: