Lineage for d3etrl1 (3etr L:2-92)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2179170Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2179355Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 2179518Protein automated matches [231466] (4 species)
    not a true protein
  7. 2179519Species Cow (Bos taurus) [TaxId:9913] [232069] (10 PDB entries)
  8. 2179535Domain d3etrl1: 3etr L:2-92 [232073]
    Other proteins in same PDB: d3etra2, d3etrb1, d3etrb2, d3etrc1, d3etrc2, d3etrl2, d3etrm1, d3etrm2, d3etrn1, d3etrn2
    automated match to d1fiqa2
    complexed with ca, fad, fes, luz, mos, mte

Details for d3etrl1

PDB Entry: 3etr (more details), 2.2 Å

PDB Description: crystal structure of xanthine oxidase in complex with lumazine
PDB Compounds: (L:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3etrl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3etrl1 d.15.4.2 (L:2-92) automated matches {Cow (Bos taurus) [TaxId: 9913]}
tadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrl
qdkiihfsanaclapictlhhvavttvegig

SCOPe Domain Coordinates for d3etrl1:

Click to download the PDB-style file with coordinates for d3etrl1.
(The format of our PDB-style files is described here.)

Timeline for d3etrl1: