Lineage for d3equa1 (3equ A:63-237)
- Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
unusual foldSuperfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families) 
automatically mapped to Pfam PF03717
Family d.175.1.0: automated matches [227232] (1 protein)
not a true familyProtein automated matches [226981] (4 species)
not a true proteinSpecies Neisseria gonorrhoeae [TaxId:485] [225540] (2 PDB entries) 
Domain d3equa1: 3equ A:63-237 [209614]
Other proteins in same PDB: d3equa2, d3equb2
automated match to d1qmea3
complexed with gol, so4
Details for d3equa1
PDB Entry: 3equ (more details), 2.4 Å
PDB Description: Crystal structure of penicillin-binding protein 2 from Neisseria gonorrhoeae
PDB Compounds: (A:) Penicillin-binding protein 2SCOPe Domain Sequences for d3equa1:
Sequence, based on SEQRES records: (download)
>d3equa1 d.175.1.0 (A:63-237) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
nrivrtqalpatrgtvsdrngavlalsapteslfavpkdmkempsaaqlerlselvdvpv
dvlrnkleqkgksfiwikrqldpkvaeevkalglenfvfekelkrhypmgnlfahvigft
didgkgqeglelsledslygedgaevvlrdrqgnivdsldsprnkapqngkdiil
Sequence, based on observed residues (ATOM records): (download)
>d3equa1 d.175.1.0 (A:63-237) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
nrivrtqalpatrgtvsdrngavlalsaptelkrhypmgnlfahvigftdidgkgqegle
lsledslygedgaevvlrdrqgnivdsldsprnkapqngkdiil
SCOPe Domain Coordinates for d3equa1:
Click to download the PDB-style file with coordinates for d3equa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3equa1:
- d3equa1 is new in SCOPe 2.03-stable
- d3equa1 appears in SCOPe 2.04
- d3equa1 appears in the current release, SCOPe 2.08
View in 3D
