Class b: All beta proteins [48724] (177 folds) |
Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) |
Family b.33.1.0: automated matches [191455] (1 protein) not a true family |
Protein automated matches [190701] (11 species) not a true protein |
Species Pseudomonas putida [TaxId:303] [188587] (3 PDB entries) |
Domain d3dqya_: 3dqy A: [174194] automated match to d1fqta_ complexed with fes |
PDB Entry: 3dqy (more details), 1.2 Å
SCOPe Domain Sequences for d3dqya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dqya_ b.33.1.0 (A:) automated matches {Pseudomonas putida [TaxId: 303]} twtyilrqgdlppgemqryeggpepvmvcnvdgeffavqdtcthgdwalsdgyldgdive ctlhfgkfcvrtgkvkalpackpikvfpikvegdevhvdldngelk
Timeline for d3dqya_: