Lineage for d3c86a_ (3c86 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2833366Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2833482Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins)
    automatically mapped to Pfam PF02126
  6. 2833483Protein Phosphotriesterase (parathion hydrolase, PTE) [51565] (5 species)
  7. 2833484Species Agrobacterium tumefaciens [TaxId:358] [141815] (17 PDB entries)
    Uniprot Q93LD7 32-360
  8. 2833490Domain d3c86a_: 3c86 A: [173082]
    automated match to d2d2ga1
    complexed with co, dpj, edo, fe2

Details for d3c86a_

PDB Entry: 3c86 (more details), 1.8 Å

PDB Description: opda from agrobacterium radiobacter with bound product diethyl thiophosphate from crystal soaking with tetraethyl dithiopyrophosphate- 1.8 a
PDB Compounds: (A:) phosphotriesterase

SCOPe Domain Sequences for d3c86a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c86a_ c.1.9.3 (A:) Phosphotriesterase (parathion hydrolase, PTE) {Agrobacterium tumefaciens [TaxId: 358]}
gdlintvrgpipvseagftlthehicgssagflrawpeffgsrkalaekavrglrharaa
gvqtivdvstfdigrdvrllaevsraadvhivaatglwfdpplsmrmrsveeltqfflre
iqhgiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtsasqrdgeqqa
aifeseglspsrvcighsddtddlsyltglaargylvgldrmpysaiglegnasalalfg
trswqtrallikalidrgykdrilvshdwlfgfssyvtnimdvmdrinpdgmafvplrvi
pflrekgvppetlagvtvanparflspt

SCOPe Domain Coordinates for d3c86a_:

Click to download the PDB-style file with coordinates for d3c86a_.
(The format of our PDB-style files is described here.)

Timeline for d3c86a_: