Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.218: Nucleotidyltransferase [81302] (1 superfamily) core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123 |
Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) |
Family d.218.1.3: Poly(A) polymerase, PAP, N-terminal domain [81589] (1 protein) insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543 |
Protein Poly(A) polymerase, PAP, N-terminal domain [81588] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81586] (5 PDB entries) |
Domain d3c66a2: 3c66 A:3-201 [155970] Other proteins in same PDB: d3c66a1, d3c66a3, d3c66a4, d3c66b1, d3c66b3, d3c66b4 automated match to d1fa0b4 protein/RNA complex; complexed with gol, mes |
PDB Entry: 3c66 (more details), 2.6 Å
SCOPe Domain Sequences for d3c66a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c66a2 d.218.1.3 (A:3-201) Poly(A) polymerase, PAP, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} sqkvfgitgpvstvgataaenklndsliqelkkegsfeteqetanrvqvlkilqelaqrf vyevskkknmsdgmardaggkiftygsyrlgvhgpgsdidtlvvvpkhvtredfftvfds llrerkeldeiapvpdafvpiikikfsgisidlicarldqpqvplsltlsdknllrnlde kdlralngtrvtdeilelv
Timeline for d3c66a2:
View in 3D Domains from other chains: (mouse over for more information) d3c66b1, d3c66b2, d3c66b3, d3c66b4 |