![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
![]() | Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
![]() | Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
![]() | Protein automated matches [190406] (14 species) not a true protein |
![]() | Species Sea anemone (Entacmaea quadricolor) [TaxId:6118] [188538] (21 PDB entries) |
![]() | Domain d3bx9a_: 3bx9 A: [172903] automated match to d1uisa_ complexed with cit, gol |
PDB Entry: 3bx9 (more details), 1.8 Å
SCOPe Domain Sequences for d3bx9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bx9a_ d.22.1.1 (A:) automated matches {Sea anemone (Entacmaea quadricolor) [TaxId: 6118]} selitenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveggplpfafdilats fmygsktfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvki rgvnfpsngpvmqkktlgweastemlypadgglegrsdmalklvggghlicnlkttyrsk kpaknlkmpgvyyvdrrlerikeadketyveqhevavarycdlpskl
Timeline for d3bx9a_: