Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.65: Formyltransferase [53327] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest |
Superfamily c.65.1: Formyltransferase [53328] (2 families) |
Family c.65.1.0: automated matches [191608] (1 protein) not a true family |
Protein automated matches [191110] (9 species) not a true protein |
Species Geobacillus kaustophilus [TaxId:235909] [231809] (1 PDB entry) |
Domain d3av3a_: 3av3 A: [231810] automated match to d4ds3a_ complexed with mg |
PDB Entry: 3av3 (more details), 1.7 Å
SCOPe Domain Sequences for d3av3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3av3a_ c.65.1.0 (A:) automated matches {Geobacillus kaustophilus [TaxId: 235909]} hmkrlavfasgsgtnfqaivdaakrgdlparvallvcdrpgakvieraarenvpafvfsp kdypskaafeseilrelkgrqidwialagymrligptllsayegkivnihpsllpafpgk daigqayragvsetgvtvhyvdegmdtgpviaqrvvpivpgepiealeerihqvehelyp tvlrmllg
Timeline for d3av3a_: