Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) |
Family c.18.1.0: automated matches [193165] (1 protein) not a true family |
Protein automated matches [193166] (5 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [231763] (2 PDB entries) |
Domain d3a7na_: 3a7n A: [231764] automated match to d3zoqa_ protein/DNA complex; complexed with flc |
PDB Entry: 3a7n (more details), 1.95 Å
SCOPe Domain Sequences for d3a7na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a7na_ c.18.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} hhgmasmtarplselvergwaaalepvadqvahmgqflraeiaagrrylpagsnvlraft fpfdnvrvlivgqdpyptpghavglsfsvapdvrpwprslanifdeytadlgyplpsngd ltpwaqrgvlllnrvltvrpsnpashrgkgweavtecairalaaraaplvailwgrdast lkpmlaagncvaiesphpsplsasrgffgsrpfsranellvgmgaepidwrlp
Timeline for d3a7na_: