Lineage for d3a7na_ (3a7n A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586283Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 1586284Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) (S)
  5. 1586387Family c.18.1.0: automated matches [193165] (1 protein)
    not a true family
  6. 1586388Protein automated matches [193166] (5 species)
    not a true protein
  7. 1586396Species Mycobacterium tuberculosis [TaxId:83332] [231763] (2 PDB entries)
  8. 1586397Domain d3a7na_: 3a7n A: [231764]
    automated match to d3zoqa_
    protein/DNA complex; complexed with flc

Details for d3a7na_

PDB Entry: 3a7n (more details), 1.95 Å

PDB Description: Crystal structure of uracil-DNA glycosylase from Mycobacterium tuberculosis
PDB Compounds: (A:) uracil-DNA glycosylase

SCOPe Domain Sequences for d3a7na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a7na_ c.18.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
hhgmasmtarplselvergwaaalepvadqvahmgqflraeiaagrrylpagsnvlraft
fpfdnvrvlivgqdpyptpghavglsfsvapdvrpwprslanifdeytadlgyplpsngd
ltpwaqrgvlllnrvltvrpsnpashrgkgweavtecairalaaraaplvailwgrdast
lkpmlaagncvaiesphpsplsasrgffgsrpfsranellvgmgaepidwrlp

SCOPe Domain Coordinates for d3a7na_:

Click to download the PDB-style file with coordinates for d3a7na_.
(The format of our PDB-style files is described here.)

Timeline for d3a7na_: