Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein automated matches [190124] (11 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186848] (19 PDB entries) |
Domain d3a33a_: 3a33 A: [171693] Other proteins in same PDB: d3a33b_ automated match to d1ur6a_ complexed with gol |
PDB Entry: 3a33 (more details), 2.2 Å
SCOPe Domain Sequences for d3a33a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a33a_ d.20.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} agsmalkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfp tdypfkppkvafttriyhpninsngsisldilrsqwspaltiskvllsicsllcdpnpdd plvpeiariyktdrekynriarewtqkyam
Timeline for d3a33a_: