Lineage for d2zc3b1 (2zc3 B:264-619)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1450060Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1450061Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1450062Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1450617Protein Penicillin-binding protein 2x (pbp-2x), transpeptidase domain [56624] (1 species)
  7. 1450618Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [56625] (10 PDB entries)
  8. 1450623Domain d2zc3b1: 2zc3 B:264-619 [154324]
    Other proteins in same PDB: d2zc3c1, d2zc3c2, d2zc3f1, d2zc3f2
    automatically matched to d1pmda4
    complexed with bmg, so4

Details for d2zc3b1

PDB Entry: 2zc3 (more details), 2.5 Å

PDB Description: Penicillin-binding protein 2X (PBP 2X) acyl-enzyme complex (biapenem) from Streptococcus pneumoniae
PDB Compounds: (B:) penicillin-binding protein 2x

SCOPe Domain Sequences for d2zc3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zc3b1 e.3.1.1 (B:264-619) Penicillin-binding protein 2x (pbp-2x), transpeptidase domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
tissplqsfmetqmdafqekvkgkymtatlvsaktgeilattqrptfdadtkegitedfv
wrdilyqsnyepgstmkvmmlaaaidnntfpggevfnsselkiadatirdwdvnegltgg
rmmtfsqgfahssnvgmtlleqkmgdatwldylnrfkfgvptrfgltdeyagqlpadniv
niaqssfgqgisvtqtqmiraftaiandgvmlepkfisaiydpndqtarksqkeivgnpv
skdaasltrtnmvlvgtdpvygtmynhstgkptvtvpgqnvalksgtaqiadeknggylv
gltdyifsavsmspaenpdfilyvtvqqpehysgiqlgefanpilerasamkdsln

SCOPe Domain Coordinates for d2zc3b1:

Click to download the PDB-style file with coordinates for d2zc3b1.
(The format of our PDB-style files is described here.)

Timeline for d2zc3b1: