Lineage for d2y5ia_ (2y5i A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1733371Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1733372Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1733398Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 1733618Protein automated matches [190132] (4 species)
    not a true protein
  7. 1733714Species Zebrafish (Danio rerio) [TaxId:7955] [189706] (1 PDB entry)
  8. 1733715Domain d2y5ia_: 2y5i A: [192787]
    automated match to d2k2fa1
    complexed with ca, ipa

Details for d2y5ia_

PDB Entry: 2y5i (more details), 2.03 Å

PDB Description: s100z from zebrafish in complex with calcium
PDB Compounds: (A:) s100 calcium binding protein z

SCOPe Domain Sequences for d2y5ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y5ia_ a.39.1.2 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
sklegamdalitvfhnysgsegdkyklskgelkellnaeltdflmsqkdpmlvekimndl
dsnkdnevdfnefvvlvaaltvacndffqeqqkkrsk

SCOPe Domain Coordinates for d2y5ia_:

Click to download the PDB-style file with coordinates for d2y5ia_.
(The format of our PDB-style files is described here.)

Timeline for d2y5ia_: