Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 proteins) structural evidence for the gene duplication within the barrel fold automatically mapped to Pfam PF00977 |
Protein automated matches [190186] (9 species) not a true protein |
Species Streptomyces coelicolor [TaxId:1902] [189237] (2 PDB entries) |
Domain d2x30a_: 2x30 A: [169836] automated match to d1vzwa1 complexed with so4; mutant |
PDB Entry: 2x30 (more details), 1.95 Å
SCOPe Domain Sequences for d2x30a_:
Sequence, based on SEQRES records: (download)
>d2x30a_ c.1.2.1 (A:) automated matches {Streptomyces coelicolor [TaxId: 1902]} msklellpavdvrdgqavrlvhgesgtetsygspleaalawqrsgaewlhlvdldaafgt gdnraliaevaqamdikvelsggirdddtlaaalatgctrvnlgtaaletpewvakviae hgdkiavgldvrgttlrgngwtrdggdlyetldrlnkegcaryvvtdiakdgtlqgpnle llknvcaatdrpvvasggvsslddlraiaglvpagvegaivgkalyakaftleealeats
>d2x30a_ c.1.2.1 (A:) automated matches {Streptomyces coelicolor [TaxId: 1902]} msklellpavdvrdgqavrlvhgesgtetsygspleaalawqrsgaewlhlvdldaafgt gdnraliaevaqamdikvelsggirdddtlaaalatgctrvnlgtaaletpewvakviae hgdkiavgldvrgttlrgngwtrdggdlyetldrlnkegcaryvvtdiapnlellknvca atdrpvvasggvsslddlraiaglvpagvegaivgkalyakaftleealeats
Timeline for d2x30a_: