Lineage for d2whya_ (2why A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1184833Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 1184930Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 1185077Family c.92.2.4: TM0189-like [142789] (4 proteins)
    Part of Pfam PF01497 that include some other superfamily members
  6. 1185090Protein automated matches [190559] (2 species)
    not a true protein
  7. 1185091Species Bacillus subtilis [TaxId:1423] [189053] (4 PDB entries)
  8. 1185093Domain d2whya_: 2why A: [169359]
    automated match to d2phza1
    complexed with cl, fe

Details for d2whya_

PDB Entry: 2why (more details), 1.7 Å

PDB Description: Crystal structure of the triscatecholate siderophore binding protein FeuA from Bacillus subtilis complexed with Ferri-Bacillibactin
PDB Compounds: (A:) Iron-uptake system-binding protein

SCOPe Domain Sequences for d2whya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2whya_ c.92.2.4 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
kkkieyldktyevtvptdkiaitgsvesmedaklldvhpqgaisfsgkfpdmfkditdka
eptgekmepniekilemkpdvilastkfpektlqkistagttipvshissnwkenmmlla
qltgkekkakkiiadyeqdlketktkindkakdskalvirirqgniyiypeqvyfnstly
gdlglkapnevkaakaqelisleklsemnpdhifvqfsddenadkpdalkdleknpiwks
lkavkedhvyvnsvdplaqggtawskvrflkaaaekltqnkla

SCOPe Domain Coordinates for d2whya_:

Click to download the PDB-style file with coordinates for d2whya_.
(The format of our PDB-style files is described here.)

Timeline for d2whya_: