![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (7 families) ![]() duplication: contains two subdomains of this fold |
![]() | Family d.58.32.6: Alditol oxidase [310621] (1 protein) Pfam PF04030; PubMed 18154360 |
![]() | Protein Alditol oxidase [310716] (1 species) |
![]() | Species Streptomyces coelicolor [TaxId:100226] [310961] (5 PDB entries) |
![]() | Domain d2vfra1: 2vfr A:180-417 [304537] Other proteins in same PDB: d2vfra2 complexed with cl, fad |
PDB Entry: 2vfr (more details), 1.1 Å
SCOPe Domain Sequences for d2vfra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vfra1 d.58.32.6 (A:180-417) Alditol oxidase {Streptomyces coelicolor [TaxId: 100226]} yemeqhvftelplagldpatfetvmaaaysvslftdwrapgfrqvwlkrrtdrpldgfpy aapaaekmhpvpgmpavncteqfgvpgpwherlphfraeftpssgaelqseylmprehal aalhamdairetlapvlqtceirtvaadaqwlspaygrdtvaahftwvedtaavlpvvrr leealvpfaarphwgkvftvpagelralyprladfgalagaldpagkftnafvrgvla
Timeline for d2vfra1: