Class b: All beta proteins [48724] (177 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins) |
Protein automated matches [190384] (19 species) not a true protein |
Species Coxsackievirus b3 [TaxId:103903] [188647] (1 PDB entry) |
Domain d2vb0a_: 2vb0 A: [168438] automated match to d1l1na_ complexed with cl |
PDB Entry: 2vb0 (more details), 2.4 Å
SCOPe Domain Sequences for d2vb0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vb0a_ b.47.1.4 (A:) automated matches {Coxsackievirus b3 [TaxId: 103903]} gpafefavammkrnsstvkteygeftmlgiydrwavlprhakpgptilmndqevgvldak elvdkdgtnleltllklnrnekfrdirgflakeevevneavlaintskfpnmyipvgqvt eygflnlggtptkrmlmynfptragqcggvlmstgkvlgihvggnghqgfsaallkhyfn deq
Timeline for d2vb0a_: