Lineage for d2vb0a_ (2vb0 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2066547Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2066750Protein automated matches [190384] (19 species)
    not a true protein
  7. 2066751Species Coxsackievirus b3 [TaxId:103903] [188647] (1 PDB entry)
  8. 2066752Domain d2vb0a_: 2vb0 A: [168438]
    automated match to d1l1na_
    complexed with cl

Details for d2vb0a_

PDB Entry: 2vb0 (more details), 2.4 Å

PDB Description: crystal structure of coxsackievirus b3 proteinase 3c
PDB Compounds: (A:) polyprotein 3bcd

SCOPe Domain Sequences for d2vb0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vb0a_ b.47.1.4 (A:) automated matches {Coxsackievirus b3 [TaxId: 103903]}
gpafefavammkrnsstvkteygeftmlgiydrwavlprhakpgptilmndqevgvldak
elvdkdgtnleltllklnrnekfrdirgflakeevevneavlaintskfpnmyipvgqvt
eygflnlggtptkrmlmynfptragqcggvlmstgkvlgihvggnghqgfsaallkhyfn
deq

SCOPe Domain Coordinates for d2vb0a_:

Click to download the PDB-style file with coordinates for d2vb0a_.
(The format of our PDB-style files is described here.)

Timeline for d2vb0a_: