Lineage for d2rdxe1 (2rdx E:2-127)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2191243Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2191244Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2191540Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2191541Protein automated matches [226922] (88 species)
    not a true protein
  7. 2192104Species Roseovarius nubinhibens [TaxId:89187] [225250] (5 PDB entries)
  8. 2192117Domain d2rdxe1: 2rdx E:2-127 [231271]
    Other proteins in same PDB: d2rdxa2, d2rdxa3, d2rdxb2, d2rdxb3, d2rdxc2, d2rdxc3, d2rdxd2, d2rdxd3, d2rdxe2, d2rdxe3, d2rdxe4, d2rdxf2, d2rdxg2, d2rdxg3, d2rdxh2, d2rdxh3
    automated match to d4mggf1
    complexed with gol, mg

Details for d2rdxe1

PDB Entry: 2rdx (more details), 2 Å

PDB Description: crystal structure of mandelate racemase/muconate lactonizing enzyme from roseovarius nubinhibens ism
PDB Compounds: (E:) Mandelate racemase/muconate lactonizing enzyme, putative

SCOPe Domain Sequences for d2rdxe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rdxe1 d.54.1.0 (E:2-127) automated matches {Roseovarius nubinhibens [TaxId: 89187]}
ritrirlyktdlpyvdgsygwgagnaitvarasvvvidtdaglqgcgeftpcgenymiah
segvdafarlaapqllgqdprqvarmerlmdhlvqghgyakapfdaafwdilgqatgqpv
wmllgg

SCOPe Domain Coordinates for d2rdxe1:

Click to download the PDB-style file with coordinates for d2rdxe1.
(The format of our PDB-style files is described here.)

Timeline for d2rdxe1: