Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins) contains a conserved all-alpha subdomain at the C-terminal extension |
Protein Tryptophanyl-tRNA synthetase (TrpRS) [52378] (5 species) overall structure is similar to TyrRS |
Species Human (Homo sapiens) [TaxId:9606] [102256] (13 PDB entries) Uniprot P23381 94-471 |
Domain d2qujb_: 2quj B: [151374] Other proteins in same PDB: d2quja3 automated match to d1r6ua_ protein/RNA complex; complexed with cl, gol, trp, tym |
PDB Entry: 2quj (more details), 2.42 Å
SCOPe Domain Sequences for d2qujb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qujb_ c.26.1.1 (B:) Tryptophanyl-tRNA synthetase (TrpRS) {Human (Homo sapiens) [TaxId: 9606]} sakgidydklivrfgsskidkelinrieratgqrphhflrrgiffshrdmnqvldayenk kpfylytgrgpsseamhvghlipfiftkwlqdvfnvplviqmtddekylwkdltldqays yavenakdiiacgfdinktfifsdldymgmssgfyknvvkiqkhvtfnqvkgifgftdsd cigkisfpaiqaapsfsnsfpqifrdrtdiqclipcaidqdpyfrmtrdvaprigypkpa llhstffpalqgaqtkmsasdpnssifltdtakqiktkvnkhafsggrdtieehrqfggn cdvdvsfmyltffledddkleqirkdytsgamltgelkkalievlqpliaehqarrkevt deivkefmtprklsfdfq
Timeline for d2qujb_: