Lineage for d2qujb_ (2quj B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2468309Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2468310Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2468404Protein Tryptophanyl-tRNA synthetase (TrpRS) [52378] (5 species)
    overall structure is similar to TyrRS
  7. 2468469Species Human (Homo sapiens) [TaxId:9606] [102256] (13 PDB entries)
    Uniprot P23381 94-471
  8. 2468475Domain d2qujb_: 2quj B: [151374]
    Other proteins in same PDB: d2quja3
    automated match to d1r6ua_
    protein/RNA complex; complexed with cl, gol, trp, tym

Details for d2qujb_

PDB Entry: 2quj (more details), 2.42 Å

PDB Description: Crystal structures of human tryptophanyl-tRNA synthetase in complex with TrpAMP
PDB Compounds: (B:) Tryptophanyl-tRNA synthetase

SCOPe Domain Sequences for d2qujb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qujb_ c.26.1.1 (B:) Tryptophanyl-tRNA synthetase (TrpRS) {Human (Homo sapiens) [TaxId: 9606]}
sakgidydklivrfgsskidkelinrieratgqrphhflrrgiffshrdmnqvldayenk
kpfylytgrgpsseamhvghlipfiftkwlqdvfnvplviqmtddekylwkdltldqays
yavenakdiiacgfdinktfifsdldymgmssgfyknvvkiqkhvtfnqvkgifgftdsd
cigkisfpaiqaapsfsnsfpqifrdrtdiqclipcaidqdpyfrmtrdvaprigypkpa
llhstffpalqgaqtkmsasdpnssifltdtakqiktkvnkhafsggrdtieehrqfggn
cdvdvsfmyltffledddkleqirkdytsgamltgelkkalievlqpliaehqarrkevt
deivkefmtprklsfdfq

SCOPe Domain Coordinates for d2qujb_:

Click to download the PDB-style file with coordinates for d2qujb_.
(The format of our PDB-style files is described here.)

Timeline for d2qujb_: