Lineage for d2qkqa_ (2qkq A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715428Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 2715476Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins)
  6. 2715544Protein automated matches [190030] (2 species)
    not a true protein
  7. 2715545Species Human (Homo sapiens) [TaxId:9606] [187366] (4 PDB entries)
  8. 2715547Domain d2qkqa_: 2qkq A: [167699]
    automated match to d1b4fb_
    complexed with cl

Details for d2qkqa_

PDB Entry: 2qkq (more details), 2.1 Å

PDB Description: Structure of the SAM Domain of Human Ephrin Type-B Receptor 4
PDB Compounds: (A:) Ephrin type-B receptor 4

SCOPe Domain Sequences for d2qkqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qkqa_ a.60.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
afgsvgewlraikmgryeesfaaagfgsfelvsqisaedllrigvtlaghqkkilasvqh
m

SCOPe Domain Coordinates for d2qkqa_:

Click to download the PDB-style file with coordinates for d2qkqa_.
(The format of our PDB-style files is described here.)

Timeline for d2qkqa_:

2715547
d2qkqa_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d2qkqb_