Lineage for d2qdha_ (2qdh A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2444581Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2444582Protein automated matches [190115] (91 species)
    not a true protein
  7. 2445336Species Trypanosome (Leishmania mexicana) [TaxId:5665] [255557] (3 PDB entries)
  8. 2445341Domain d2qdha_: 2qdh A: [150666]
    automated match to d2alda_
    complexed with m2p

Details for d2qdha_

PDB Entry: 2qdh (more details), 1.9 Å

PDB Description: fructose-1,6-bisphosphate aldolase from leishmania mexicana in complex with mannitol-1,6-bisphosphate, a competitive inhibitor
PDB Compounds: (A:) fructose-1,6-bisphosphate aldolase

SCOPe Domain Sequences for d2qdha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qdha_ c.1.10.0 (A:) automated matches {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
msrvtvlqsqlpaynrlktpyeseliatvkklttpgkgllaadesigsctkrfqpiglsn
teehrrqyralmleaegfeqyisgvilhdetvgqkasngqtfpeyltargvvpgiktdmg
lcpllegaegeqmtegldgyvkrasayykkgcrfckwrnvykiqngtvsesavrfnaetl
aryailsqmsglvpivepevmidgkhdidtcqrvsehvwrevvaalqrhgviwegcllkp
nmvvpgaesgktaapeqvahytvmtlartmpamlpgvmflsgglsevqaseylnainnsp
lprpyflsfsyaralqssalkawggkesglaagrraflhrarmnsmaqlgkykrsdddas
ssslyv

SCOPe Domain Coordinates for d2qdha_:

Click to download the PDB-style file with coordinates for d2qdha_.
(The format of our PDB-style files is described here.)

Timeline for d2qdha_: