Lineage for d2q98a_ (2q98 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1730528Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1730529Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1730530Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)
  6. 1730600Protein Prolactin (placental lactogen) [47278] (2 species)
  7. 1730601Species Human (Homo sapiens) [TaxId:9606] [89035] (3 PDB entries)
  8. 1730603Domain d2q98a_: 2q98 A: [167483]
    automated match to d1n9da_

Details for d2q98a_

PDB Entry: 2q98 (more details), 2.7 Å

PDB Description: x-ray structure of a prolactin antagonist
PDB Compounds: (A:) Prolactin

SCOPe Domain Sequences for d2q98a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q98a_ a.26.1.1 (A:) Prolactin (placental lactogen) {Human (Homo sapiens) [TaxId: 9606]}
mrsqvtlrdlfdravvlshyihnlssemfsefdkrythgrgfitkainschtsslatped
keqaqqmnqkdflslivsilrswneplyhlvtevrgmqeapeailskaveieeqtkrlle
rmelivsqvhpetkeneiypvwsglpslqmadeesrlsayynllhclrrdshkidnylkl
lkcriihnnnc

SCOPe Domain Coordinates for d2q98a_:

Click to download the PDB-style file with coordinates for d2q98a_.
(The format of our PDB-style files is described here.)

Timeline for d2q98a_: